PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00951g07003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 150aa    MW: 17771.9 Da    PI: 4.5518
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00951g07003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.41e-141658244
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                              +ien+  r+ tfskRr+g+ KKA+EL  + d+++ vi+fs+t 
  Peinf101Scf00951g07003.1 16 KIENEDDRYATFSKRRTGLYKKASELVKMSDVDIGVILFSPTA 58
                              59**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.923757IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-15768IPR002100Transcription factor, MADS-box
CDDcd001203.05E-21857No hitNo description
SuperFamilySSF554551.07E-17892IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-10929IPR002100Transcription factor, MADS-box
PfamPF003191.9E-171658IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-102944IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-104465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MEYKKTLGRQ KIPMIKIENE DDRYATFSKR RTGLYKKASE LVKMSDVDIG VILFSPTAES  60
IVDRFLSPNR QLSESSRLVA AHSRNRVNEI YNRLDEYDII EDAISDQFFE PDEMNEADQR  120
SWWKSIEDFN EDEVTKFEVD LAKFCCFRYD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595152.11e-58PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_016446657.11e-58PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4BSX18e-46K4BSX1_SOLLC; Uncharacterized protein
STRINGSolyc04g056740.1.12e-45(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.17e-21AGAMOUS-like 61